Analytical Data
-
Gene name
KIF13B
- Application
-
Alternative Names
GAKIN; Guanylate kinase associated kinesin; KI13B_HUMAN; KIAA0639; KIF 13B; KIF13B; Kinesin 13B; Kinesin family member 13B; Kinesin like protein GAKIN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NQT8
-
Expression Region
1-100aa
-
AA Sequence
MGDSKVKVAVRIRPMNRRETDLHTKCVVDVDANKVILNPVNTNLSKGDARGQPKVFAYDHCFWSMDESVKEKYAGQDIVFKCLGENILQNAFDGYNACIF
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIF13B, a member of the kinesin superfamily of motor proteins, is crucial for intracellular transport processes, particularly in the anterograde transport of organelles and vesicles along microtubules. This protein plays a significant role in several physiological processes, including neuronal development, signaling pathways, and cellular maintenance. Research has highlighted its involvement in various diseases, notably in cancer and neurodegenerative disorders, due to its role in modulating cellular transport dynamics. The recombinant protein of KIF13B has become a focus of study for understanding its functional mechanisms and interactions at the molecular level. By producing this protein in a laboratory setting, researchers aim to elucidate its structure-function relationship, investigate its binding partners, and explore its potential as a therapeutic target or biomarker. The implications of this research extend beyond basic science, offering insights into therapeutic strategies for diseases linked with impaired intracellular transport mechanisms. Overall, the study of KIF13B recombinant protein is essential for uncovering the complexities of cellular transport and its impact on health and disease.
