Cat: IPD-X12476

Recombinant Canine Ephrin-B2/EFNB2 Protein(HEK293), C-His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Ephrin-B2/EFNB2

  • 简介

    Ephrin-B2/EFNB2 Protein, a member of the ephrin family, serves as a transmembrane ligand, interacting with its Eph receptor to initiate bidirectional signaling. Crucial in developmental processes like tissue boundary formation, axon guidance, angiogenesis, and synaptic plasticity, Ephrin-B2/EFNB2 is implicated in conditions like cancer, cardiovascular diseases, and neurological disorders, making it a potential therapeutic target. Ephrin-B2/EFNB2 Protein, Canine (HEK293, His) is the recombinant canine-derived Ephrin-B2/EFNB2 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Immobilized canine EFNB2-His at 10 μg/mL (100 μL /well) can bind Human EphB4. The ED50 for this effect is 16.44 ng/mL. Immobilized canine EFNB2-His at 10 μg/mL (100 μL /well) can bind Human EphB4. The ED50 for this effect is 16.44 ng/mL.

  • Alternative Names

    Ephrin-B2; LERK-5; HTK-L; EFNB2; EPLG5

  • Species

    Canine

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    B0LDS6

  • Expression Region

    I28-A229

  • AA Sequence

    IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNRDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARHNDPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGSSAGHSGNNILGSEVALFA

  • Protein Length

    Partial

  • Molecular Weight

    The protein migrates as 25-35 kDa under reducing SDS-PAGE due to glycosylation.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Ephrin-B2 (EFNB2) is a member of the ephrin family, which plays crucial roles in cell-cell communication and signaling during embryonic development and in the nervous system. EFNB2 is particularly significant for its involvement in angiogenesis, neuronal guidance, and immune responses. It interacts with Eph receptors, triggering bidirectional signaling pathways that influence cell migration, adhesion, and tissue organization. Research has shown that alterations in EFNB2 expression can contribute to various pathological conditions, including cancer, where its role in tumor progression and metastasis has garnered interest. The recombinant production of Ephrin-B2 protein facilitates detailed studies on its structure-function relationships and provides a valuable tool for investigating its biological activities. By expressing EFNB2 in various cellular contexts, scientists aim to elucidate its mechanisms of action and its potential as a therapeutic target. Understanding Ephrin-B2's involvement in disease processes could open avenues for the development of novel therapies that modulate its activity, thus providing new strategies for treatment in conditions such as cancer and neurodegenerative diseases. Overall, the research on EFNB2 recombinant proteins not only enhances our comprehension of fundamental biological processes but also paves the way for innovative therapeutic approaches.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US