Analytical Data
-
Gene name
ssuE
- Application
-
Alternative Names
ssuE;ycbP;FMN reductase (NADPH)
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P80644
-
Expression Region
1-191aa
-
AA Sequence
MRVITLAGSPRFPSRSSSLLEYAREKLNGLDVEVYHWNLQNFAPEDLLYARFDSPALKTFTEQLQQADGLIVATPVYKAAYSGALKTLLDLLPERALQGKVVLPLATGGTVAHLLAVDYALKPVLSALKAQEILHGVFADDSQVIDYHHRPQFTPNLQTRLDTALETFWQALHRRDVQVPDLLSLRGNAHA
-
Molecular Weight
26.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on ssuE recombinant proteins is rooted in the growing interest in understanding the biochemical and physiological roles of sulfur metabolism in various organisms. The ssuE gene is part of the sulfur assimilation pathway, which is crucial for organisms to incorporate sulfur into essential biomolecules like amino acids and coenzymes. Studies have shown that ssuE encodes a protein involved in the conversion of sulfite to sulfide, a key step in this pathway. Investigating the recombinant form of ssuE provides insights into its enzymatic mechanisms, substrate specificity, and potential regulatory roles within the sulfur metabolism framework. Moreover, utilizing recombinant DNA technology allows for the expression and purification of the ssuE protein, facilitating detailed structural and functional analyses. This research not only enhances our understanding of microbial ecology and the sulfur cycle but also has implications for biotechnological applications, such as bioenergy production and bioremediation, where sulfur assimilation plays a vital role. By elucidating the properties and functions of ssuE recombinant proteins, scientists aim to develop novel strategies to manipulate sulfur metabolic pathways, potentially leading to advancements in environmental biotechnology and agricultural practices. Overall, the study of ssuE recombinant proteins represents a significant contribution to our comprehension of sulfur dynamics and its broader impacts on ecosystem health and sustainability.











