Analytical Data
-
Gene name
NR4A1
- Application
-
Alternative Names
NR4A1;GFRP1;HMR;NAK1;Nuclear receptor subfamily 4immunitygroup A member 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22736
-
Expression Region
1-598aa
-
AA Sequence
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
-
Molecular Weight
68.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NR4A1, also known as nur77, is an orphan nuclear receptor that plays a crucial role in various biological processes, including cell proliferation, apoptosis, and immune response regulation. Research on NR4A1 has garnered significant attention due to its potential implications in cancer, metabolic disorders, and cardiovascular diseases. It functions as a transcription factor, influencing the expression of genes related to these pathways. Aberrant expression of NR4A1 has been linked to tumor progression and poor prognosis in several types of cancer, making it a target for therapeutic intervention. Furthermore, NR4A1 is involved in the regulation of inflammation, suggesting its role in autoimmune diseases. The study of NR4A1 recombinant proteins allows researchers to investigate its structure-function relationships and mechanisms of action in detail. By producing recombinant NR4A1, scientists can assess its interaction with various ligands, co-factors, and target genes, contributing to a better understanding of its biological roles and therapeutic potentials. This research may provide insights into new treatment strategies that modulate NR4A1 activity in disease contexts.











