Cat: PA2000-4580

Recombinant Human mazF Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    mazF

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    mazF;chpA;chpAK;Endoribonuclease toxin MazF

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0AE70

  • Expression Region

    1-111aa

  • AA Sequence

    MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG

  • Molecular Weight

    13.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MazF is an endoribonuclease discovered in Escherichia coli and is part of the mazEF toxin-antitoxin system, which plays a crucial role in bacterial response to stress and regulation of cell death. This system is particularly interesting because MazF acts by cleaving mRNA, leading to growth inhibition, which helps the bacteria survive adverse conditions. The study of MazF has garnered attention not only for its regulatory functions in bacterial physiology but also for its potential biotechnological applications, including the development of novel antimicrobial agents. Furthermore, as antibiotic resistance becomes a growing global concern, understanding the mechanisms of MazF and its interactions within the cellular environment could pave the way for innovative therapeutic strategies. Researchers have focused on the structural and functional characterization of MazF to elucidate its enzymatic activity and specificity towards RNA substrates. By utilizing advanced techniques like X-ray crystallography and NMR spectroscopy, insights into its catalytic mechanisms have been gained, providing valuable information for the design of inhibitors that could modulate its activity. Overall, the exploration of MazF represents a promising avenue for both fundamental microbiological research and practical applications in combating antibiotic-resistant pathogens.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US