Analytical Data
-
Gene name
LAMTOR2
- Application
-
Alternative Names
LAMTOR2;MAPBPIP;ROBLD3;Ragulator complex Protein LAMTOR2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2Q5
-
Expression Region
1-125aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMLRPKALTQVLSQANTGGVQSTLLLN NEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDC MEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LAMTOR2 (Late Endosomal/Lysosomal Adaptation Protein 2) plays a critical role in the mTOR (mechanistic target of rapamycin) signaling pathway, which is central to cellular growth, proliferation, and metabolism. This protein is part of the larger LAMTOR (Late Endosomal/MAPK-Organizing Protein) complex, involved in the regulation of lysosomal function and nutrient sensing. Research indicates that LAMTOR2 interacts with various signaling molecules, influencing cellular responses to growth factors and nutrients. Mutations or dysregulation of LAMTOR2 have been implicated in several diseases, including cancer and metabolic disorders, highlighting its importance in maintaining cellular homeostasis. The recombinant production of LAMTOR2 has become essential for understanding its structure-function relationships and for investigating its role in mTOR signaling. By generating LAMTOR2 as a recombinant protein, researchers can explore its biochemical properties, interactions with other proteins, and its contribution to lysosomal dynamics. This line of research not only enhances our understanding of fundamental cellular processes but also opens avenues for therapeutic interventions targeting mTOR-related diseases.
