Analytical Data
-
Gene name
Ccl19
- Application
-
Alternative Names
Ccl19；ELC；MIP3B；SCYA19；C-C motif chemokine 19
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99731
-
Expression Region
22-98aa
-
AA Sequence
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
-
Molecular Weight
35.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ccl19, a chemokine belonging to the CC subfamily, plays a crucial role in the immune system by orchestrating the migration and activation of immune cells, particularly dendritic cells and T lymphocytes. Understanding Ccl19's biological functions and mechanisms has garnered significant interest in immunology and therapeutic research. Given its pivotal role in lymphocyte trafficking and tissue homeostasis, Ccl19 is implicated in various diseases, including autoimmune disorders, infections, and cancer. The recombinant production of Ccl19 protein enables researchers to investigate its structural and functional properties in detail, facilitating studies on receptor interactions and downstream signaling pathways. Furthermore, Ccl19 has potential therapeutic applications, such as in vaccine development and enhancing immune responses, making its recombinant form a valuable tool in both basic and applied research. Additionally, studying Ccl19 can provide insights into the development of strategies to modulate immune responses for treating chronic inflammatory diseases and improving cancer immunotherapy. Overall, the investigation of Ccl19 recombinant protein represents a promising avenue for advancing our understanding of immune regulation and developing innovative therapeutic approaches.
