Analytical Data
-
Gene name
LGR4
- Application
-
Alternative Names
LGR4；GPR48；Leucine-rich repeat-containing G-Protein coupled receptor 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BXB1
-
Expression Region
25-544aa
-
AA Sequence
APPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLT
-
Molecular Weight
62.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LGR4 (Leucine-rich repeat-containing G protein-coupled receptor 4) is a member of the G protein-coupled receptor family, which plays a significant role in various biological processes, including cell proliferation, differentiation, and signaling pathways essential for development and tissue homeostasis. Studies have suggested that LGR4 participates in the regulation of stem cell activity and has a crucial function in organ development and reproductive biology. Its involvement in several diseases, particularly cancer and metabolic disorders, has sparked interest in the therapeutic potential of targeting LGR4. The importance of LGR4 in modulating signal transduction pathways, particularly those related to the Wnt and β-catenin signaling cascades, highlights its relevance in both normal physiology and pathophysiological conditions. By investigating the recombinant protein forms of LGR4, researchers aim to elucidate the receptor's precise mechanisms of action, establish its role in disease etiology, and explore its potential as a biomarker or therapeutic target. The production of LGR4 recombinant proteins allows for in-depth studies, including ligand-binding assays and functional assays, which can provide insights into its structure-function relationships and interactions with other cellular components. As a result, LGR4 is not only a critical player in understanding fundamental biological processes but also represents a promising avenue for therapeutic intervention in a variety of diseases. The aim of ongoing research is to further characterize LGR4's functions, investigate its roles in various biological contexts, and exploit this knowledge for innovative treatment strategies.
