Analytical Data
-
Gene name
HLA-DRB1
- Application
-
Alternative Names
HLA-DRB1;HLA class II histocompatibility antigen. DRB1 beta chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
D7RIG5
-
Expression Region
30-266aa
-
AA Sequence
GDTQPRFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRRVHPEVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS&IKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIKGVRKSNAAERRGPL
-
Molecular Weight
28.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HLA-DRB1 is a critical gene within the human major histocompatibility complex (MHC) that plays a pivotal role in the immune system by encoding a protein essential for presenting antigens to T cells. Variants of HLA-DRB1 are associated with various autoimmune diseases, including rheumatoid arthritis and multiple sclerosis, making it a focal point for medical research. The study of HLA-DRB1 recombinant proteins is significant for understanding its structural and functional properties, which can elucidate how specific alleles influence immune responses and susceptibility to diseases. Furthermore, recombinant proteins derived from HLA-DRB1 are invaluable in developing diagnostic tools and therapeutic strategies, including vaccine design and personalized medicine approaches. By examining the interactions between HLA-DRB1 and T cell receptors, researchers aim to gain insights into immune regulatory mechanisms, paving the way for innovative treatments in immunology and autoimmune disease management.
