Analytical Data
-
Gene name
IFNA21
- Application
-
Alternative Names
IFNA21; Interferon alpha-21; IFN-alpha-21; Interferon alpha-F; LeIF F
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01568
-
Expression Region
24-189aa
-
AA Sequence
CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
-
Molecular Weight
21.3kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IFNA21, a member of the interferon-alpha family, plays a crucial role in the innate immune response against viral infections. Its primary function is to activate signaling pathways that induce the expression of interferon-stimulated genes (ISGs), enhancing the host's antiviral defenses. The study of IFNA21 has gained significant attention due to its potential therapeutic applications in treating viral diseases, autoimmune disorders, and certain cancers. Recent advancements in biotechnology allow for the efficient production of recombinant IFNA21, enabling researchers to investigate its biological activity and efficacy in preclinical models. Furthermore, understanding the structure-function relationship of this protein can provide insights into its mechanisms of action, paving the way for novel interventions that harness the power of the immune system. Overall, the research on IFNA21 recombinant protein not only enhances our understanding of immune regulation but also holds promise for innovative treatments in infectious diseases and immunological conditions.
