Analytical Data
-
Gene name
IFI27
- Application
-
Alternative Names
IFI27; Interferon alpha-inducible protein 27. mitochondrial; p27; Interferon alpha-induced 11.5 kDa protein; Interferon-stimulated gene 12a protein; ISG12(a; ISG12A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P40305
-
Expression Region
1-119aa
-
AA Sequence
MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY
-
Molecular Weight
38.83 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IFI27 (Interferon-Inducible Protein 27) is a member of the interferon-stimulated gene family and plays a critical role in the immune response, particularly in viral infections and inflammation. It is known to be highly expressed in response to interferon stimulation, which is part of the body's innate immune defense mechanism. Research has shown that IFI27 is involved in various biological processes, including apoptosis, cell proliferation, and the regulation of inflammatory pathways. Its expression levels have been associated with several diseases, including cancers and autoimmune disorders, making it a potential biomarker for diagnosis and prognosis. Due to its involvement in antiviral defense and immune regulation, IFI27 has garnered interest as a therapeutic target and as a candidate for vaccine development. Recent studies involving recombinant IFI27 proteins have sought to elucidate its functional mechanisms and interactions at the molecular level, offering insights into its potential applications in enhancing immune responses. Understanding the structure and function of IFI27 is crucial for developing innovative therapeutic strategies that could boost immunity or modulate inflammatory responses in clinical settings.











