Analytical Data
-
Gene name
UBC8
- Application
-
Alternative Names
UBC8;UBCH8;Ubiquitin/ISG15-conjugating enzyme E2 L6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14933
-
Expression Region
1-153aa
-
AA Sequence
MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
-
Molecular Weight
17.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UBC8 is a key component of the ubiquitin-proteasome system, an essential pathway for protein degradation and regulation in eukaryotic cells. This non-classical E2 ubiquitin-conjugating enzyme plays a critical role in tagging proteins for degradation, thereby regulating various cellular processes such as cell cycle progression, DNA repair, and response to stress. The study of UBC8 recombinant proteins has gained traction due to its potential implications in understanding diseases associated with proteostasis, including cancer and neurodegenerative disorders. Researchers are particularly interested in delineating the structural characteristics of UBC8, as well as its enzymatic mechanisms and interaction with other ubiquitin-related proteins. Utilizing recombinant DNA technology, scientists can produce UBC8 in heterologous systems, allowing for detailed biochemical and biophysical analyses. These studies aim to elucidate the functional roles of UBC8 in the ubiquitin-ligase cascade and explore its potential as a therapeutic target. Moreover, insights gained from UBC8 research could pave the way for the development of innovative strategies to manipulate protein degradation pathways and enhance cellular resilience against pathologies. As the understanding of UBC8 and its functions expands, it holds promise not only for basic biological research but also for developing novel therapeutic interventions.











