Cat: PA2000-4238

Recombinant Human ndkC-1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ndkC-1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ndkC-1;gip17;ndkB;ndkC-2;Nucleoside diphosphate kinase. cytosolic

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P22887

  • Expression Region

    1-155aa

  • AA Sequence

    MSTNKVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE

  • Molecular Weight

    16.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The NdkC-1 protein, a member of the nucleoside diphosphate kinase (NDK) family, has attracted research interest due to its crucial role in cellular metabolism and signal transduction. This enzyme is involved in the synthesis of nucleoside triphosphates, which are vital for various biological processes, including DNA and RNA synthesis, energy transfer, and cell signaling. NdkC-1 has been implicated in various physiological and pathological contexts, including cellular proliferation, differentiation, and stress responses. Its unique structural and functional properties differentiate it from other NDK isoforms, making it a potential target for therapeutic interventions. Recent studies have indicated that NdkC-1 expression levels may correlate with certain diseases, such as cancer, suggesting that a deeper understanding of its mechanisms could provide insights into disease progression and potential treatment strategies. Furthermore, the recombinant expression of NdkC-1 in heterologous systems allows for the detailed characterization of its biochemical properties and interactions, paving the way for future research focused on elucidating its functional roles in cellular processes. Overall, the study of NdkC-1 offers a promising avenue for both basic research and medical applications, highlighting the importance of this protein in maintaining cellular homeostasis and its potential relevance in disease states.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US