Analytical Data
-
Gene name
ndkC-1
- Application
-
Alternative Names
ndkC-1;gip17;ndkB;ndkC-2;Nucleoside diphosphate kinase. cytosolic
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22887
-
Expression Region
1-155aa
-
AA Sequence
MSTNKVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
-
Molecular Weight
16.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The NdkC-1 protein, a member of the nucleoside diphosphate kinase (NDK) family, has attracted research interest due to its crucial role in cellular metabolism and signal transduction. This enzyme is involved in the synthesis of nucleoside triphosphates, which are vital for various biological processes, including DNA and RNA synthesis, energy transfer, and cell signaling. NdkC-1 has been implicated in various physiological and pathological contexts, including cellular proliferation, differentiation, and stress responses. Its unique structural and functional properties differentiate it from other NDK isoforms, making it a potential target for therapeutic interventions. Recent studies have indicated that NdkC-1 expression levels may correlate with certain diseases, such as cancer, suggesting that a deeper understanding of its mechanisms could provide insights into disease progression and potential treatment strategies. Furthermore, the recombinant expression of NdkC-1 in heterologous systems allows for the detailed characterization of its biochemical properties and interactions, paving the way for future research focused on elucidating its functional roles in cellular processes. Overall, the study of NdkC-1 offers a promising avenue for both basic research and medical applications, highlighting the importance of this protein in maintaining cellular homeostasis and its potential relevance in disease states.











