Analytical Data
-
Gene name
HBZ
- Application
-
Alternative Names
HBZ;HBZ2;Hemoglobin subunit zeta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02008
-
Expression Region
1-142aa
-
AA Sequence
SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
-
Molecular Weight
42.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HBZ (HBV X protein) is a multifaceted protein encoded by the hepatitis B virus (HBV), which plays a crucial role in the virus's lifecycle and pathogenesis. The research background of HBZ recombinant protein is rooted in the need to understand the molecular mechanisms underlying HBV infection and its associated diseases, particularly chronic hepatitis, cirrhosis, and hepatocellular carcinoma (HCC). HBZ is known to interfere with host cell signaling pathways, contributing to immune evasion and oncogenesis. As such, studies focusing on recombinant forms of HBZ aim to elucidate its structure, function, and interactions with host cellular proteins. By utilizing recombinant DNA technology, researchers can produce HBZ in a controlled environment, allowing for detailed biochemical and biophysical characterization. This in-depth exploration is essential for developing novel therapeutic strategies, including vaccines and antiviral agents targeting HBV. Furthermore, understanding HBZ's role in promoting tumorigenesis could lead to new insights into cancer biology, providing a potential avenue for innovative cancer therapies. Overall, the investigation of HBZ recombinant protein is vital for advancing our knowledge of HBV-related diseases and pioneering effective treatment options.
