Analytical Data
-
Gene name
AAP6
- Application
-
Alternative Names
AAP6；Amino acid permease 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P92934
-
Expression Region
1-481aa
-
AA Sequence
MEKKKSMFVEQSFPEHEIGDTNKNFDEDGRDKRTGTWMTGSAHIITAVIGSGVLSLAWAIAQLGWVAGPAVLMAFSFITYFTSTMLADCYRSPDPVTGKRNYTYMEVVRSYLGGRKVQLCGLAQYGNLIGITIGYTITASISMVAVKRSNCFHKNGHNVKCATSNTPFMIIFAIIQIILSQIPNFHNLSWLSILAAVMSFCYASIGVGLSIAKAAGGGEHVRTTLTGVTVGIDVSGAEKIWRTFQAIGDIAFAYAYSTVLIEIQDTLKAGPPSENKAMKRASLVGVSTTTFFYMLCGCVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVCIAVHLIGAYQVFCQPIFQFVESQSAKRWPDNKFITGEYKIHVPCCGDFSINFLRLVWRTSYVVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQKKIPKFSFTWTWLKILSWTCFIVSLVAAAGSVQGLIQSLKDFKPFQAP
-
Molecular Weight
53.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AAP6, also known as amino acid permease 6, is a member of the high-affinity amino acid transporter family and has garnered significant interest in recent years due to its crucial role in various physiological processes. Found primarily in plants, AAP6 is essential for the uptake of neutral amino acids, influencing plant growth, development, and stress responses. Understanding the function and regulation of AAP6 is vital for optimizing nutrient use efficiency in crops, which is increasingly important in the context of global food security and sustainable agriculture. Research has indicated that AAP6 expression is regulated by various environmental factors, including nitrogen availability and abiotic stressors, suggesting its potential for bioengineering to improve nutrient uptake and resilience in crops. Furthermore, the study of AAP6 can provide insights into the broader mechanisms of amino acid transport and metabolism, which are fundamental to both plant and animal physiology. As such, AAP6 represents a compelling target for biotechnological advancements aimed at enhancing agricultural productivity, particularly in a rapidly changing global climate.
