Analytical Data
-
Gene name
GSTK1
- Application
-
Alternative Names
GSTK1;Glutathione S-transferase kappa 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2Q3
-
Expression Region
2-226aa
-
AA Sequence
GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
-
Molecular Weight
52.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GSTK1, or Glutathione S-Transferase K1, is a member of the glutathione S-transferase (GST) superfamily, which is known for its role in detoxification processes within cells. GSTs are critical enzymes that catalyze the conjugation of glutathione to various substrates, thus facilitating the excretion of potentially harmful compounds. The study of GSTK1 has gained significance due to its involvement in metabolic pathways and its potential implications in drug metabolism and resistance. Additionally, GSTK1 has been implicated in various diseases, including cancer, where altered expression levels may contribute to tumor progression and therapy resistance. Recent research has focused on the structural and functional characteristics of GSTK1, including its substrate specificity and interaction with different ligands. The recombinant expression of GSTK1 allows for detailed biochemical assays and structural studies, shedding light on its catalytic mechanisms and potential as a therapeutic target. Understanding GSTK1's role in cellular defense mechanisms not only aids in deciphering its biological functions but also opens avenues for the development of novel pharmacological agents aimed at modulating its activity in disease contexts.
