Analytical Data
-
Gene name
GUCY2F
- Application
-
Alternative Names
GUCY2F; GUC2F; RETGC2; Retinal guanylyl cyclase 2; RETGC-2; EC 4.6.1.2; Guanylate cyclase 2F; retinal; Guanylate cyclase F; GC-F; Rod outer segment membrane guanylate cyclase 2; ROS-GC2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51841
-
Expression Region
311-402aa
-
AA Sequence
VLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWELHS
-
Molecular Weight
37.73 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GUCY2F, also known as guanylate cyclase 2F, is a receptor important in various cellular signaling pathways, primarily associated with nitric oxide (NO) signaling and the regulation of intracellular cGMP levels. The gene encoding GUCY2F is expressed predominantly in the retina, where it plays a crucial role in phototransduction and vision. Research into GUCY2F has gained momentum due to its involvement in retinal diseases and potential therapeutic targets for conditions such as retinitis pigmentosa and other forms of vision loss. Understanding the structure and function of the GUCY2F protein through recombinant expression allows researchers to study its biochemical characteristics, elucidate its signaling mechanisms, and explore how mutations can lead to dysfunction. Additionally, the development of GUCY2F reconstituted proteins provides a valuable tool for drug screening and the discovery of novel compounds that may enhance or inhibit its activity. Overall, the recombinant study of GUCY2F represents a significant frontier in molecular biology and biophysics, with implications for regenerative medicine and the treatment of ocular diseases.
