Analytical Data
-
Gene name
GUCY2D
- Application
-
Alternative Names
GUCY2D. CORD6. GUC1A4. GUC2D. RETGC. RETGC1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q02846
-
Expression Region
521-630aa
-
AA Sequence
RKVAQGSRSSLGARSMSDIRSGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDL
-
Molecular Weight
37.73 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GUCY2D is a gene that encodes the enzyme guanylate cyclase 2D, which plays a crucial role in the phototransduction pathway of retinal photoreceptor cells. Mutations in this gene are associated with various forms of inherited retinal dystrophies, including Leber congenital amaurosis and retinitis pigmentosa, leading to severe vision loss. Research on GUCY2D and its recombinant protein form is vital for understanding the molecular mechanisms underlying these diseases, which can help in developing potential gene therapy and pharmacological interventions. Recent advances in recombinant protein technology allow for the production of GUCY2D in host systems, which can then be analyzed for its structural and functional properties. Studying the biochemical characteristics of the GUCY2D protein, including its catalytic activity and interaction with other retinal proteins, is essential for uncovering the pathways disturbed by mutations. Additionally, the recombinant protein can serve as a valuable tool for drug screening and the identification of small molecules that could restore function in affected individuals. Overall, ongoing research on GUCY2D recombinant protein not only enhances our understanding of retinal diseases but also paves the way for innovative therapeutic strategies aimed at restoring vision.
