Analytical Data
-
Gene name
TMEM219
- Application
-
Alternative Names
TMEM219；Insulin-like growth factor-binding Protein 3 receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86XT9
-
Expression Region
39-204aa
-
AA Sequence
SFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSR
-
Molecular Weight
22.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM219, a member of the transmembrane protein family, has garnered attention due to its potential role in various cellular processes, including cell signaling and membrane trafficking. Recent studies suggest that TMEM219 may be involved in cellular responses to stress and inflammation, highlighting its relevance in pathophysiological conditions such as neurodegenerative diseases and cancer. The ability to produce recombinant TMEM219 protein has opened avenues for in-depth characterization of its structure and function. By utilizing recombinant DNA technology, researchers can express and purify TMEM219, enabling the exploration of its interactions with other cellular components and delineating its biological roles. Understanding the functional mechanisms of TMEM219 could provide insights into its contributions to cellular homeostasis and disease progression, making it a target of interest for therapeutic interventions. The research surrounding TMEM219 recombinant protein is poised to uncover critical information regarding its potential applications in biotechnology and medicine, thus paving the way for future studies aimed at exploiting its functions in health and disease.
