Cat: PA1000-1128

Recombinant Human FIBP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FIBP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FIBP;Acidic fibroblast growth factor intracellular-binding Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43427

  • Expression Region

    1-364aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMTSELDIFVGNTTLIDEDVYRLWLDGY SVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLL HQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKT GITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIV FFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVGEAPTDPDSQMD DMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEA NFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFF LNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fibroblast-specific protein 1 (FSP1), also known as FIBP or fibroblast activation protein, has gained significant attention in recent years due to its essential role in various physiological and pathological processes. This protein is primarily expressed in fibroblasts, playing critical roles in tissue remodeling, wound healing, and tumor microenvironment dynamics. The study of FIBP has become increasingly relevant in cancer research because it is associated with tumor progression and metastasis. Elevated levels of FIBP in the tumor stroma are linked to poor prognosis in several cancer types, implicating its involvement in promoting an aggressive tumor phenotype. Researchers aim to better understand the molecular mechanisms governing FIBP expression and its interactions with other cellular components. In addition, the development of recombinant FIBP proteins has opened new avenues for studying its functional properties and potential therapeutic applications. By leveraging advanced biotechnological methods, scientists are investigating ways to inhibit FIBP activity, which could lead to novel strategies for cancer treatment. This burgeoning field of research emphasizes the need for comprehensive studies that dissect FIBP's role in the tumor microenvironment and its potential as a biomarker for cancer prognosis, thus paving the way for innovative therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US