Analytical Data
-
Gene name
GRID2
- Application
-
Alternative Names
delta-2; GluD2; GLUR D2; GluR delta 2; GluR delta-2 subunit; GLURD 2; GLURD2; Glutamate receptor delta 2 subunit ; Glutamate receptor ionotropic; Glutamate receptor ionotropic delta 2; GRID 2; Grid2; GRID2_HUMAN; MGC117022; MGC117023; MGC117024
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43424
-
Expression Region
908-1007aa
-
AA Sequence
DTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of GRID2, or Glutamate Receptor Interacting Protein 2, has garnered significant attention in the neuroscience and molecular biology fields due to its critical role in synaptic transmission and plasticity. GRID2 is primarily expressed in the brain, where it interacts with the ionotropic glutamate receptors, particularly the delta and AMPA receptor subtypes. Research has indicated that GRID2 is essential for the proper localization of these receptors at synapses, influencing their trafficking and function. Dysregulation of GRID2 has been implicated in various neurological disorders, including autism spectrum disorders, intellectual disabilities, and other cognitive impairments. The reconstitution of GRID2 protein has become a focal point for elucidating its molecular mechanisms and physiological functions. By producing recombinant GRID2, researchers aim to investigate its interactions with various proteins, its role in receptor signaling pathways, and its contribution to synaptic architecture. This understanding could pave the way for novel therapeutic strategies targeting GRID2-associated pathologies. Ultimately, studies on GRID2 proteins not only enhance our comprehension of fundamental synaptic processes but also hold promise for addressing disorders linked to glutamatergic signaling disruptions.
