Cat: PA1000-9735

Recombinant Human KRT7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KRT7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KRT7;HHA7;HKA7;KRTHA7;Keratin. type I cuticular Ha7

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P08729

  • Expression Region

    1-469aa

  • AA Sequence

    MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVA VRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNN KFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRG QLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKD VDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMD NSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDD LRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDA RAKQEELEAALQRAKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEE SRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPG LLKAYSIRTASASRRSARD

  • Molecular Weight

    78 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KRT7, or Keratin 7, is a member of the keratin family of proteins that play a crucial role in maintaining the structural integrity of epithelial cells. It is primarily expressed in simple epithelial tissues such as those found in the respiratory, gastrointestinal, and genitourinary tracts. KRT7 has garnered significant interest in biomedical research due to its association with various pathological conditions, including cancers, fibrotic diseases, and autoimmune disorders. The expression of KRT7 can serve as a critical biomarker for certain tumors, aiding in their diagnosis and prognosis. The study of KRT7 recombinant proteins has advanced our understanding of its functional roles and interactions within cells, enabling the exploration of therapeutic avenues aimed at modulating its activity. Furthermore, insights gained from KRT7 research have implications for tissue engineering and regenerative medicine, as this protein is essential for maintaining the mechanical properties of tissues. As researchers continue to unravel the complexities of KRT7's functions, its potential applications in targeted therapies and diagnostic tools are becoming increasingly evident, highlighting the protein's significance in both health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US