Analytical Data
-
Gene name
SF3B3
- Application
-
Alternative Names
SF3B3;KIAA0017;SAP130;Splicing factor 3B subunit 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15393
-
Expression Region
819-1217aa
-
AA Sequence
MAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNIGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF
-
Molecular Weight
52.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SF3B3, a vital component of the splicing machinery in eukaryotic cells, is part of the SF3B complex, which plays a critical role in pre-mRNA splicing. The proper functioning of SF3B3 is crucial for accurate mRNA processing, which in turn affects gene expression and cellular function. Dysregulation or mutations in SF3B3 have been linked to various diseases, including cancer and neurodegenerative disorders, highlighting its importance in maintaining cellular homeostasis. Recent studies have revealed that SF3B3 not only contributes to pre-mRNA splicing but also has other roles in regulating RNA metabolism and cellular signaling pathways. This multifaceted role positions SF3B3 as a potential therapeutic target. Understanding its structure and function through recombinant protein studies can provide insights into the molecular mechanisms governing RNA splicing and contribute to the development of novel treatment strategies for diseases associated with splicing disorders. The investigation of recombinant SF3B3 protein allows for the exploration of its biochemical properties, interaction with other splicing factors, and its role in the alternative splicing of pre-mRNA. Consequently, research on SF3B3 is pivotal not only for fundamental biological understanding but also for its implications in disease pathology and potential therapeutic avenues.











