Analytical Data
-
Gene name
stcE
- Application
-
Alternative Names
stcE；C1IN；C1NH；Plasma protease C1 inhibitor
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O82882
-
Expression Region
296-551aa
-
AA Sequence
ELLLHTIDIGMLTTPRDRFDFAKDKEAHREYFQTIPVSRMIVNNYAPLHLKEVMLPTGELLTDMDPGNGGWHSGTMRQRIGKELVSHGIDNANYGLNSTAGLGENSHPYVVAQLAAHNSRGNYANGIQVHGGSGGGGIVTLDSTLGNEFSHEVGHNYGLGHYVDGFKGSVHRSAENNNSTWGWDGDKKRFIPNFYPSQTNEKSCLNNQCQEPFDGHKFGFDAMAGGSPFSAANRFTMYTPNSSAIIQRFFENKAVF
-
Molecular Weight
33.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The stcE protein is a significant virulence factor produced by certain pathogenic strains of Escherichia coli, especially Enterohemorrhagic E. coli (EHEC) and Enterotoxigenic E. coli (ETEC). This protein is involved in the bacterium's ability to cause severe gastrointestinal diseases, including diarrhea and hemolytic uremic syndrome (HUS). Research into the stcE protein has gained momentum due to the increasing incidence of E. coli-related outbreaks and the public health challenges they pose. Studies suggest that stcE plays a critical role in the manipulation of host cell processes, facilitating bacterial survival and enhancing the pathogen's ability to evade the host immune response. Thus, understanding the molecular mechanisms of stcE is crucial for developing potential therapeutic strategies and vaccines. The production of recombinant stcE protein allows for detailed characterization of its properties and interactions with host cells, providing insights into its role in pathogenesis. Furthermore, the investigation of stcE may contribute to broader research on bacterial virulence factors and lead to innovative approaches to combat E. coli infections. This research area underscores the importance of tackling foodborne pathogens and highlights the need for continued exploration of bacterial proteins that contribute to disease.
