Analytical Data
-
Gene name
FABP1
- Application
-
Alternative Names
FABP1；FABPL;Fatty acid-binding Protein. liver
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07148
-
Expression Region
1-127aa
-
AA Sequence
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
-
Molecular Weight
16.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fatty Acid Binding Protein 1 (FABP1), a member of the FABP family, plays a critical role in the intracellular transport and metabolism of fatty acids, influencing various physiological processes, including lipid metabolism and insulin sensitivity. Studies have shown that FABP1 is primarily expressed in the liver and is involved in the regulation of lipid homeostasis and inflammation. Its significance extends beyond basic metabolism, as altered FABP1 expression is associated with metabolic disorders, such as obesity and type 2 diabetes. Researchers are increasingly interested in recombinant FABP1 proteins for their potential applications in drug development and therapeutic strategies, as well as their utility in unraveling the intricate molecular mechanisms underlying fat metabolism. Recombinant production of FABP1 has made it possible to explore its structure-function relationships, enabling detailed studies on how FABP1 interacts with fatty acids and other cellular targets. Understanding these interactions may lead to the identification of novel biomarkers for metabolic diseases and facilitate the design of targeted therapies aimed at combating disorders linked to dysregulated lipid metabolism. Furthermore, FABP1's role in cellular signaling pathways highlights its potential as a therapeutic target, making recombinant FABP1 an important focus of current biomedical research aimed at addressing global health issues related to obesity and metabolic syndrome. As such, the elucidation of FABP1's functions through recombinant protein studies represents a promising frontier in the quest to develop innovative interventions for metabolic diseases.
