Analytical Data
-
Gene name
SART3
- Application
-
Alternative Names
SART3；KIAA0156；TIP110；Squamous cell carcinoma antigen recognized by T-cells 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15020
-
Expression Region
600-900aa
-
AA Sequence
QRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLP
-
Molecular Weight
35.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SART3, a member of the cancer/testis antigen family, has garnered significant attention in the field of immunology and cancer research due to its specific expression in testicular germ cells and certain tumors, making it a potential biomarker for cancer diagnosis and a target for immunotherapy. Research indicates that SART3 plays a role in cellular processes such as pre-mRNA splicing and has been implicated in tumorigenesis. Characterizing SART3 as a recombinant protein allows for detailed studies of its structure, function, and immunogenic properties, which can enhance our understanding of its role in cancer development. Moreover, the generation of SART3 recombinant proteins facilitates the exploration of its potential as a therapeutic target, paving the way for vaccine development aimed at eliciting an immune response against cancer cells expressing this antigen. Investigating SART3 not only contributes to the broader knowledge of cancer/testis antigens but also holds promise for improving precision medicine approaches in oncology, where targeting specific tumor antigens can lead to more effective treatments with fewer side effects.
