Analytical Data
-
Gene name
DAPP1
- Application
-
Alternative Names
DAPP1；BAM32；Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UN19
-
Expression Region
1-280aa
-
AA Sequence
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLL SNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFS SLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQT GRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQM SPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEW IKILRWKLSQIRKQLNQGEGTIRSRSFIFK
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DAPP1, or Dual Adaptors for Phosphotyrosine-containing Proteins-1, is a critical protein involved in the signaling pathways of the immune system, particularly in B cell receptor signaling. It functions as an adaptor protein that links phosphorylated tyrosine residues on receptors to downstream signaling molecules, thus playing a pivotal role in the activation and regulation of B cells. The study of DAPP1 has garnered significant attention due to its implications in various immunological processes, including cell proliferation, differentiation, and survival. Abnormalities in DAPP1 expression or function have been associated with autoimmune diseases and malignancies, underscoring the necessity for a deeper understanding of its mechanisms. Recent research has focused on the structural and functional characterization of DAPP1, with an aim to elucidate the molecular interactions it mediates. The recombinant production of DAPP1 has enabled researchers to systematically study its properties, including binding affinities and the effects of post-translational modifications. This work is essential for identifying potential therapeutic targets and developing new strategies for treating diseases linked to dysregulated immune responses. The comprehensive investigation of DAPP1's role in signaling pathways could ultimately lead to innovative approaches in immunotherapy and enhance our understanding of immune system intricacies.
