Analytical Data
-
Gene name
NR4A2
- Application
-
Alternative Names
NR4A2；NOT；NURR1；TINUR；Nuclear receptor subfamily 4 group A member 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43354
-
Expression Region
1-598aa
-
AA Sequence
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
-
Molecular Weight
68.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NR4A2, a member of the nuclear receptor superfamily, plays a crucial role in various biological processes, including neurogenesis, metabolism, and inflammation. It serves as a transcription factor that regulates gene expression in response to hormonal signals and environmental stimuli. The research background of NR4A2 recombinant proteins primarily focuses on its involvement in neurological disorders, such as Parkinson's disease and schizophrenia, where it has been implicated in neuronal survival and differentiation. Additionally, NR4A2 is recognized for its potential as a therapeutic target due to its role in modulating inflammatory responses and cellular metabolism. By generating recombinant NR4A2 proteins, researchers aim to investigate the structure-function relationships of this receptor, understand its signaling pathways, and explore its interactions with other proteins. Such studies are essential for elucidating the mechanisms through which NR4A2 influences various cellular processes and for developing novel therapeutic strategies that could leverage its functions in disease contexts. Furthermore, recombinant NR4A2 protein can be used in drug screening assays, enabling the identification of small molecules that can modulate its activity as potential treatments for related disorders. The exploration of NR4A2's functional roles and its implications in health and disease underscores the importance of continued research in this domain, paving the way for advancements in targeted therapeutics and improved understanding of neuronal and metabolic regulation.
