Analytical Data
-
Gene name
FPGT
- Application
-
Alternative Names
FPGT；GFPP；Fucose-1-phosphate guanylyltransferase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14772
-
Expression Region
1-594aa
-
AA Sequence
MAAARDPPEVSLREATQRKLRRFSELRGKLVARGEFWDIVAITAADEKQELAYNQQLSEKLKRKELPLGVQYHVFVDPAGAKIGNGGSTLCALQCLEKLYGDKWNSFTILLIHSGGYSQRLPNASALGKIFTALPLGNPIYQMLELKLAMYIDFPLNMNPGILVTCADDIELYSIGEFEFIRFDKPGFTALAHPSSLTIGTTHGVFVLDPFDDLKHRDLEYRSCHRFLHKPSIEKMYQFNAVCRPGNFCQQDFAGGDIADLKLDSDYVYTDSLFYMDHKSAKMLLAFYEKIGTLSCEIDAYGDFLQALGPGATVEYTRNTSNVIKEESELVEMRQRIFHLLKGTSLNVVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIPECSGKTSCIIQSILDSRCSVAPGSVVEYSRLGPDVSVGENCIISGSYILTKAALPAHSFVCSLSLKMNRCLKYATMAFGVQDNLKKSVKTLSDIKLLQFFGVCFLSCLDVWNLKVTEELFSGNKTCLSLWTARIFPVCSSLSDSVITSLKMLNAVKNKSAFSLNSYKLLSIEEMLIYKDVEDMITYREQIFLEISLKSSLM
-
Molecular Weight
68.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FPGT (Fructose-1-Phosphate Aldolase) is an enzyme that plays a critical role in carbohydrate metabolism, particularly in the conversion of fructose-1-phosphate into dihydroxyacetone phosphate and glyceraldehyde. Research into FPGT and its recombinant protein has gained traction due to its potential applications in metabolic engineering, biotechnology, and medicine. The understanding of FPGT's specific mechanisms and functionalities can facilitate the development of new therapeutic strategies for metabolic disorders, including fructose intolerance and certain hereditary metabolic diseases. Additionally, the expression of recombinant FPGT in a suitable host can lead to enhanced enzymatic activity, providing valuable tools for biocatalysis in industrial processes involving sugar metabolism. The ability to manipulate FPGT at the genetic and protein levels opens new avenues for studying carbohydrate metabolism and improving the efficiency of biosynthetic pathways, which is particularly important in the context of sustainable bioprocessing and the production of biofuels and biochemicals. As such, the research on recombinant FPGT not only enhances scientific knowledge but also promotes the development of innovative biotechnological applications that could have significant implications for health and industry.
