Analytical Data
-
Gene name
HDAC7
- Application
-
Alternative Names
HDAC7;HDAC7A;Histone deacetylase 7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WUI4
-
Expression Region
4-203aa
-
AA Sequence
PGADGTQVSPGAHYCSPTGAGCPRPCADTPGPQPQPMDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYK
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Histone deacetylase 7 (HDAC7) is a member of the class IIa histone deacetylases, which plays a crucial role in the regulation of gene expression by removing acetyl groups from histone proteins, thereby influencing chromatin structure and function. HDAC7 is known to be involved in various cellular processes, including cell differentiation, proliferation, and apoptosis. Abnormal expression or activity of HDAC7 has been linked to several diseases, including cancer and cardiac dysfunction, making it a significant target for therapeutic intervention. Recent studies have focused on the structural characterization and functional analysis of recombinant HDAC7 to better understand its enzymatic properties and biochemical interactions. The production of recombinant HDAC7 allows researchers to examine its role in the deacetylation of histone and non-histone proteins, investigate its interactions with other regulatory proteins, and assess its potential as a therapeutic target. Furthermore, recombinant HDAC7 can be utilized to screen for small molecule inhibitors, offering the possibility of developing new treatments for diseases associated with HDAC7 dysregulation. Overall, the exploration of recombinant HDAC7 is essential for unraveling the complexities of its biological functions and its implications in health and disease.











