Analytical Data
-
Gene name
VMAT2
- Application
-
Alternative Names
VMAT2;SVMT;VMAT2;Synaptic vesicular amine transporter
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q05940
-
Expression Region
53-151aa
-
AA Sequence
HEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTA TQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGL
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VMAT2 (vesicular monoamine transporter 2) is a critical protein involved in the transport of monoamines, such as dopamine, serotonin, and norepinephrine, into synaptic vesicles, playing a pivotal role in neurotransmitter regulation and storage. Dysregulation of VMAT2 has been implicated in various neuropsychiatric disorders, including depression, schizophrenia, and Parkinson's disease. Given its significant role in neurotransmission, researchers have been increasingly interested in studying VMAT2 at the molecular level, particularly through the development of recombinant proteins. The ability to produce VMAT2 as a recombinant protein enables detailed biochemical and biophysical studies, facilitating the exploration of its structure-function relationships and interactions with substrates and inhibitors. Furthermore, recombinant VMAT2 can be utilized in high-throughput screening assays for novel therapeutic agents aimed at modulating its activity. These studies are essential for advancing our understanding of the pathophysiological mechanisms underlying neuropsychiatric disorders and for the development of targeted therapies. Overall, VMAT2 research represents a promising frontier in neuroscience, where elucidating the mechanisms of monoamine transport could lead to significant breakthroughs in the treatment of various mental health conditions.











