Analytical Data
-
Gene name
SGLT2
- Application
-
Alternative Names
SGLT2;SGLT2;Sodium/glucose cotransporter 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31639
-
Expression Region
228-277aa
-
AA Sequence
GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SGLT2 (Sodium-Glucose Cotransporter 2) is a key protein involved in glucose reabsorption in the kidneys, playing a significant role in the regulation of blood glucose levels. Research on SGLT2 has gained substantial attention due to its implications in diabetes management, particularly in Type 2 diabetes mellitus (T2DM). The discovery of SGLT2 inhibitors has transformed diabetes treatment by promoting glycemic control and offering cardiovascular and renal protective benefits. As a membrane protein, SGLT2's structure and function have been extensively studied to understand its mechanism and interactions within the renal proximal tubule. Recent advancements in recombinant protein technology enable the production of functional SGLT2 proteins for research purposes, allowing scientists to explore its biochemical properties, substrate specificity, and potential drug interactions. Understanding SGLT2 at a molecular level facilitates the development of novel therapeutic strategies aimed at enhancing glucose disposal and minimizing diabetic complications. Additionally, ongoing research focuses on exploring the role of SGLT2 beyond glucose transport, including its involvement in kidney function and potential links to metabolic pathways. Given the global rise in diabetes prevalence, elucidating the SGLT2 mechanism through recombinant protein studies holds promise for innovative treatment modalities and improving patient outcomes in the management of diabetes and associated comorbidities.











