Cat: PA1000-887DB

Recombinant Human DKK3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DKK3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DKK3;REIC;Dickkopf-related Protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UBP4

  • Expression Region

    22-350aa

  • AA Sequence

    APAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEE MEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNN QTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPC RGQRMLCTRDSECCGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCA FQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGL LCQPHSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYEVGSFMEEVRQEL EDLERSLTEEMALGEPAAAAAALLGGEEI

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DKK3 (Dickkopf-related protein 3) is a member of the Dickkopf family, which plays a crucial role in the regulation of Wnt signaling pathways, essential for various biological processes including embryonic development, tissue regeneration, and cellular differentiation. The dysregulation of DKK3 has been implicated in several pathological conditions, particularly in cancer where it can influence tumor growth and metastasis. The study of DKK3 recombinant proteins has garnered significant interest due to their potential therapeutic applications in oncological and regenerative medicine. By expressing DKK3 as a recombinant protein, researchers aim to elucidate its functional mechanisms, interaction with its receptors, and downstream signaling pathways. Furthermore, understanding the role of DKK3 in tumor microenvironments could pave the way for novel strategies to combat cancer and improve regenerative therapy outcomes. Experimental approaches involving recombinant DKK3 protein allow for detailed examination of its biological effects, potential as a biomarker, and underlying mechanisms, potentially providing insights for therapeutic interventions targeting Wnt signaling dysregulation. Researchers are also exploring ways to enhance the efficacy of DKK3 by modifying its structure or delivery methods, which could lead to innovative treatments that leverage its biological properties. Overall, the investigation of DKK3 recombinant proteins stands at the intersection of molecular biology and clinical application, highlighting the significance of this protein in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US