Analytical Data
-
Gene name
DKK3
- Application
-
Alternative Names
DKK3;REIC;Dickkopf-related Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBP4
-
Expression Region
22-350aa
-
AA Sequence
APAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEE MEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNN QTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPC RGQRMLCTRDSECCGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCA FQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGL LCQPHSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYEVGSFMEEVRQEL EDLERSLTEEMALGEPAAAAAALLGGEEI
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DKK3 (Dickkopf-related protein 3) is a member of the Dickkopf family, which plays a crucial role in the regulation of Wnt signaling pathways, essential for various biological processes including embryonic development, tissue regeneration, and cellular differentiation. The dysregulation of DKK3 has been implicated in several pathological conditions, particularly in cancer where it can influence tumor growth and metastasis. The study of DKK3 recombinant proteins has garnered significant interest due to their potential therapeutic applications in oncological and regenerative medicine. By expressing DKK3 as a recombinant protein, researchers aim to elucidate its functional mechanisms, interaction with its receptors, and downstream signaling pathways. Furthermore, understanding the role of DKK3 in tumor microenvironments could pave the way for novel strategies to combat cancer and improve regenerative therapy outcomes. Experimental approaches involving recombinant DKK3 protein allow for detailed examination of its biological effects, potential as a biomarker, and underlying mechanisms, potentially providing insights for therapeutic interventions targeting Wnt signaling dysregulation. Researchers are also exploring ways to enhance the efficacy of DKK3 by modifying its structure or delivery methods, which could lead to innovative treatments that leverage its biological properties. Overall, the investigation of DKK3 recombinant proteins stands at the intersection of molecular biology and clinical application, highlighting the significance of this protein in health and disease.











