Analytical Data
-
Gene name
rpsU
- Application
-
Alternative Names
rpsU；C16orf49；Ubiquinone biosynthesis Protein COQ9. mitochondrial
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P68679
-
Expression Region
2-71aa
-
AA Sequence
PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARENARRTRLY
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the RpsU protein, a component of the ribosomal 30S subunit, has garnered significant attention due to its crucial role in bacterial protein synthesis and its potential implications in antimicrobial resistance. RpsU, also known as ribosomal protein S21, is integral to the assembly and function of the ribosome, which is essential for translation processes in prokaryotic cells. Understanding its structure and function can provide insights into the fundamental mechanisms of ribosomal activity and the ways in which antibiotics can disrupt these processes. Research has indicated that variations in RpsU can affect ribosome biogenesis and fidelity of protein synthesis, presenting a unique target for the development of novel antibacterial agents. Additionally, as bacterial resistance to conventional antibiotics continues to rise, elucidating the role of RpsU in ribosome dynamics could pave the way for innovative strategies to combat resistant strains by rendering them susceptible through targeted interventions. The recombination and study of RpsU also offer valuable opportunities to explore its interactions with other ribosomal proteins and RNA, enhancing our understanding of ribosomal assembly and function in bacteria. Overall, the functional analysis and characterization of RpsU not only contribute to the fundamental knowledge of bacterial ribosomes but also hold promise for the development of new therapeutic approaches in the fight against antibiotic-resistant infections.
