Analytical Data
-
Gene name
DEFB118
- Application
-
Alternative Names
DEFB118；C20orf63；DEFB18；ESC42;Defensin beta 118
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96PH6
-
Expression Region
21-123aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSYSGEKKCWNRSGHCRKQCKDGEAVKDT CKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVS SKKDMVEESEAGRGTETSLPNVHHSS
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Defensin Beta 118 (DEFB118) is a member of the human defensin family, which plays a crucial role in the innate immune system. These small cationic peptides are primarily expressed in the epithelial tissues and serve as antimicrobial agents, providing the first line of defense against a variety of pathogens, including bacteria, viruses, and fungi. DEFB118 specifically is known for its ability to disrupt microbial membranes, making it a potential candidate for antimicrobial therapy. Research into DEFB118 has gained momentum owing to its promising therapeutic applications, especially in the context of increasing antibiotic resistance. Furthermore, studies have suggested that DEFB118 may also have immunomodulatory functions, influencing inflammation and wound healing processes. Given its multifaceted roles in host defense and potential clinical applications, understanding the structure, function, and regulation of DEFB118 through recombinant protein production has become a significant focus of research. By utilizing recombinant DNA technology to produce DEFB118, scientists aim to explore its functional mechanisms, optimize its antimicrobial properties, and investigate its potential as a therapeutic agent in treating infectious diseases and enhancing immune responses. This growing body of research underscores the importance of DEFB118 in both basic immunology and applied biomedical science.
