Cat: PA1000-847DB

Recombinant Human DCXR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DCXR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DCXR;SDR20C1;L-xylulose reductase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q7Z4W1

  • Expression Region

    1-244aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMELFLAGRRVLVTGAGKGIGRGTVQALHAT GARVVAVSRTQADLDSLVRECPGIEPVCVDLGDWEATERALGSVGPVDLL VNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGA IVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPT VVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMT TGSTLPVEGGFWAC

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DCXR (Dicarbonyl/L-xylulose reductase) is an enzyme that plays a crucial role in the metabolism of reactive dicarbonyl compounds and the conversion of L-xylulose to D-xylulose, which is essential in the pentose phosphate pathway. Researchers have shown that DCXR is implicated in various physiological and pathological processes, including diabetes and its complications, as well as cellular stress responses due to its ability to reduce toxic dicarbonyls. This enzyme is of particular interest because it can impact the formation of advanced glycation end-products (AGEs) that contribute to diabetic complications and age-related diseases. Despite its potential therapeutic significance, the detailed biochemical properties and structural characteristics of DCXR remain underexplored, necessitating further investigation. Recent studies have aimed to express and purify recombinant DCXR to better understand its kinetic behavior, substrate specificity, and role in cellular defense mechanisms against oxidative stress. The recombinant forms of the enzyme are also being examined for their potential applications in biotechnology, particularly in the development of drugs and therapeutic strategies targeting dysregulated dicarbonyl levels in tissues. This research direction holds promise for advancing knowledge of metabolic dysregulation in diabetes and other diseases while offering insights into potential interventions that leverage the unique properties of DCXR.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US