Cat: PA2000-3583

Recombinant Human NDUFA2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NDUFA2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NDUFA2;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43678

  • Expression Region

    1-99aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAAAAASRGVGAKLGLREIRIHLCQRS PGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNV PLNNFSADQVTRALENVLSGKA

  • Molecular Weight

    13 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NDUFA2, or NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2, is a crucial component of the mitochondrial NADH:ubiquinone oxidoreductase complex, commonly known as Complex I. This multi-subunit enzyme plays a vital role in the electron transport chain, facilitating the transfer of electrons derived from NADH to ubiquinone, thereby contributing to ATP production through oxidative phosphorylation. Mutations or dysfunctions in NDUFA2 have been implicated in various mitochondrial diseases, leading to deficits in cellular energy metabolism, oxidative stress, and neurodegenerative disorders. Research on NDUFA2 recombinant proteins aims to elucidate its structural and functional properties, providing insights into the molecular mechanisms underlying Complex I assembly and activity. Through approaches such as X-ray crystallography, cryo-electron microscopy, and enzyme activity assays, scientists are working to understand how alterations in NDUFA2 affect mitochondrial function and overall cellular health. This research not only enhances our comprehension of mitochondrial biology but also opens avenues for therapeutic strategies targeting mitochondrial dysfunction, which is increasingly linked to a variety of metabolic and age-related diseases. Furthermore, studying NDUFA2 can contribute to developing diagnostic tools for mitochondrial disorders, enabling early detection and intervention, thereby improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US