Analytical Data
-
Gene name
HNRNPD
- Application
-
Alternative Names
HNRNPD；AUF1；HNRPD；Heterogeneous nuclear ribonucleoProtein D0
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14103
-
Expression Region
2-355aa
-
AA Sequence
SEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY
-
Molecular Weight
65.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HNRNPD, also known as heterogeneous nuclear ribonucleoprotein D, is a crucial protein involved in various aspects of RNA metabolism, including splicing, localization, and stability of mRNA. Research has shown that HNRNPD plays a significant role in regulating gene expression and is implicated in several cellular processes, such as cell proliferation and differentiation. Dysregulation of HNRNPD has been associated with various diseases, including cancer and neurodegenerative disorders. The recombinant HNRNPD protein serves as an important tool for studying the protein's functional mechanisms and interactions with RNA and other cellular components. By producing HNRNPD in a recombinant form, researchers can investigate its structural properties, binding affinities, and the effects of post-translational modifications. Additionally, this research can provide insights into the functional impact of HNRNPD in cellular pathways and its potential as a therapeutic target. Overall, the study of recombinant HNRNPD not only enhances our understanding of RNA biology but also addresses its role in disease contexts, paving the way for future research and therapeutic developments.
