Analytical Data
-
Gene name
CILP2
- Application
-
Alternative Names
CILP2；Cartilage intermediate layer Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IUL8
-
Expression Region
956-1113AA
-
AA Sequence
HNAGGSHPRTRGQLYGLRDARSVRDPERPGTSAACVEFKCSGMLFDQRQVDRTLVTIMPQGSCRRVAVNGLLRDYLTRHPPPVPAEDPAAFSMLAPLDPLGHNYGVYTVTDQSPRLAKEIAIGRCFDGSSDGFSREMKADAGTAVTFQCREPPAGRPS
-
Molecular Weight
47.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CILP2, or Cartilage Intermediate Layer Protein 2, is a significant extracellular matrix component primarily expressed in cartilage and plays a crucial role in maintaining cartilage structure and function. Research into CILP2 has gained attention due to its potential involvement in osteoarthritis and other cartilage-related diseases. Studies have shown that CILP2 may affect chondrocyte behavior, influencing cell proliferation, differentiation, and matrix production. Understanding the molecular mechanisms underlying CILP2 function is vital for developing targeted therapies for cartilage degeneration. Furthermore, the recombinant protein of CILP2 offers a valuable tool for investigating its biological properties and interactions, allowing researchers to explore its potential as a biomarker for cartilage health and disease progression. The production of CILP2 as a recombinant protein also enables the study of its role in various cellular processes in vitro and in vivo, paving the way for new therapeutic strategies aimed at preserving cartilage integrity and promoting repair mechanisms. Overall, the investigation of CILP2 and its recombinant forms holds promise for enhancing our understanding of cartilage biology and addressing prevalent joint disorders.
