Analytical Data
-
Gene name
TMEM119
- Application
-
Alternative Names
TMEM119;Transmembrane Protein 119
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q4V9L6
-
Expression Region
26-96aa
-
AA Sequence
RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLG GPSPPTNFLDGIVDFFRQYVM
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM119, or Transmembrane Protein 119, has emerged as a significant marker for microglial cells, the resident immune cells in the central nervous system. Research on TMEM119 has gained traction due to its potential role in neuroinflammatory diseases and neurodegenerative disorders, such as Alzheimer's disease and multiple sclerosis, where altered microglial activity is observed. The distinct expression pattern of TMEM119 exclusively in microglia, as opposed to other glial cells, makes it a valuable tool for understanding microglial biology and function. Recent studies have sought to elucidate the structure and function of TMEM119 by producing recombinant protein, which can help in characterizing its interactions and signaling pathways. This research is critical for uncovering the mechanisms underlying microglial activation and their contribution to neuroinflammation, providing insights that could lead to novel therapeutic strategies for treating CNS disorders. By using TMEM119 as a focal point, scientists aim to better understand microglial roles in health and disease, paving the way for advancements in neurotherapeutics.











