Cat: PA2000-3544

Recombinant Human TMEM119 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TMEM119

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TMEM119;Transmembrane Protein 119

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q4V9L6

  • Expression Region

    26-96aa

  • AA Sequence

    RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLG GPSPPTNFLDGIVDFFRQYVM

  • Molecular Weight

    29 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TMEM119, or Transmembrane Protein 119, has emerged as a significant marker for microglial cells, the resident immune cells in the central nervous system. Research on TMEM119 has gained traction due to its potential role in neuroinflammatory diseases and neurodegenerative disorders, such as Alzheimer's disease and multiple sclerosis, where altered microglial activity is observed. The distinct expression pattern of TMEM119 exclusively in microglia, as opposed to other glial cells, makes it a valuable tool for understanding microglial biology and function. Recent studies have sought to elucidate the structure and function of TMEM119 by producing recombinant protein, which can help in characterizing its interactions and signaling pathways. This research is critical for uncovering the mechanisms underlying microglial activation and their contribution to neuroinflammation, providing insights that could lead to novel therapeutic strategies for treating CNS disorders. By using TMEM119 as a focal point, scientists aim to better understand microglial roles in health and disease, paving the way for advancements in neurotherapeutics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US