Analytical Data
-
Gene name
SLC25A15
- Application
-
Alternative Names
SLC25A15；ORC1；ORNT1；Mitochondrial ornithine transporter 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y619
-
Expression Region
1-301aa
-
AA Sequence
MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY
-
Molecular Weight
59.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A15, also known as the aspartate/glutamate carrier (AGC), is a mitochondrial transport protein that plays a crucial role in cellular metabolism by facilitating the exchange of aspartate and glutamate across the mitochondrial inner membrane. Understanding SLC25A15 is imperative due to its involvement in various physiological processes, including amino acid homeostasis and mitochondrial function, which are critical for energy production and cellular signaling. Dysregulation of SLC25A15 has been implicated in several pathological conditions, including neurological disorders, metabolic syndromes, and certain cancers. The recombinant expression of SLC25A15 in heterologous systems allows researchers to study its function, substrate specificity, and regulatory mechanisms in a controlled environment. This is particularly important for elucidating its role in metabolic pathways and its potential as a therapeutic target. Moreover, understanding the structure-function relationship of SLC25A15 can provide insights into its interaction with other mitochondrial proteins and metabolites, thereby advancing our knowledge of mitochondrial dynamics and its impact on overall cellular health. The generation of recombinant SLC25A15 is also crucial for potential applications in drug discovery and the development of novel therapeutic interventions aimed at modulating mitochondrial function in various diseases. Therefore, ongoing research into the recombinant protein SLC25A15 holds significant promise for both basic science and clinical applications.
