Cat: PA1000-754DB

Recombinant Human CST9 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CST9

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CST9;CLM;CTES7A;Cystatin-9

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5W186

  • Expression Region

    29-159aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMWCSEEEMGGNNKIVQDPMFLATVEFALNT FNVQSKEEHAYRLLRVLS SWREDSMDRKWRGKMVFSMNLQLRQTVCRK FEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAAD KAI PRDKGK

  • Molecular Weight

    17 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CST9, a cysteine protease inhibitor, has garnered considerable attention in the field of biochemical research due to its potential roles in various physiological and pathological processes. Initially identified as a crucial component in the regulation of proteolytic enzymes, CST9 is believed to play a significant role in modulating inflammation, cell signaling, and immune responses. Its expression has been linked to various diseases, including cancer and neurodegenerative disorders, where dysregulation of proteolysis is a hallmark. Researchers have focused on the characterization of CST9's structure and function to understand its mechanisms of action, as well as its interactions with specific protein targets. By engineering recombinant CST9 protein, scientists aim to explore its therapeutic potential and application in targeted therapies, particularly as a biomarker for disease progression and treatment efficacy. The development of recombinant CST9 also opens avenues for investigating its inhibitory effects on proteases in various biological systems, offering insights into its role in maintaining cellular homeostasis. This burgeoning area of research underscores the importance of CST9 in health and disease, making it a significant focus for future studies aimed at therapeutic interventions and the development of novel biomedical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US