Analytical Data
-
Gene name
CST9
- Application
-
Alternative Names
CST9;CLM;CTES7A;Cystatin-9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5W186
-
Expression Region
29-159aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMWCSEEEMGGNNKIVQDPMFLATVEFALNT FNVQSKEEHAYRLLRVLS SWREDSMDRKWRGKMVFSMNLQLRQTVCRK FEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAAD KAI PRDKGK
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CST9, a cysteine protease inhibitor, has garnered considerable attention in the field of biochemical research due to its potential roles in various physiological and pathological processes. Initially identified as a crucial component in the regulation of proteolytic enzymes, CST9 is believed to play a significant role in modulating inflammation, cell signaling, and immune responses. Its expression has been linked to various diseases, including cancer and neurodegenerative disorders, where dysregulation of proteolysis is a hallmark. Researchers have focused on the characterization of CST9's structure and function to understand its mechanisms of action, as well as its interactions with specific protein targets. By engineering recombinant CST9 protein, scientists aim to explore its therapeutic potential and application in targeted therapies, particularly as a biomarker for disease progression and treatment efficacy. The development of recombinant CST9 also opens avenues for investigating its inhibitory effects on proteases in various biological systems, offering insights into its role in maintaining cellular homeostasis. This burgeoning area of research underscores the importance of CST9 in health and disease, making it a significant focus for future studies aimed at therapeutic interventions and the development of novel biomedical applications.











