Cat: PA1000-753DB

Recombinant Human CST7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CST7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CST7;Cystatin-F

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O76096

  • Expression Region

    20-145aa

  • AA Sequence

    GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFL FKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLK QTLSCYSEVWVVPWLQHFEVPVLRCHVDHHHHHH

  • Molecular Weight

    16 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CST7 (cystatin 7) is a member of the cystatin superfamily, which serves as an important class of cysteine protease inhibitors. The study of CST7 has gained significant attention due to its potential roles in various biological processes and pathological conditions. Initially recognized for its involvement in the regulation of proteolytic activity, CST7 has been implicated in immune responses, cellular proliferation, and apoptosis. Recent research has indicated that CST7 may play a key role in the modulation of inflammatory processes and the pathogenesis of autoimmune diseases. Additionally, aberrant expression of CST7 has been linked to cancer progression, highlighting its potential as a biomarker and therapeutic target. Investigations into the structure and function of CST7 are facilitated by the development of recombinant proteins that allow for detailed biochemical analyses. These studies are crucial for elucidating CST7's mechanism of action and its interactions within various signaling pathways. As a result, ongoing research focuses on the characterization of CST7 recombinant proteins to explore their functional implications in health and disease, paving the way for novel therapeutic strategies that leverage CST7's regulatory capabilities.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US