Cat: PA1000-9424

Recombinant Human LDHC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LDHC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LDHC;LDH3;LDHX;;L-lactate dehydrogenase C chain

  • Species

    Human

  • Source

    E. coli

  • Tag

    His Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P07864

  • Expression Region

    1-332aa

  • AA Sequence

    MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF

  • Molecular Weight

    37kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Lactate dehydrogenase C (LDHC) is an enzyme that plays a crucial role in the conversion of lactate to pyruvate, which is essential for cellular metabolism and energy production. Unlike other lactate dehydrogenases, LDHC is predominantly expressed in germ cells, particularly in testes, suggesting a specialized role in male fertility and spermatogenesis. Research has shown that LDHC is involved in regulating the metabolic switch necessary for sperm development and function. Abnormal expression or mutations in the LDHC gene have been associated with male infertility, making it a critical target for studies on reproductive health. The development of recombinant LDHC proteins allows for the exploration of its biochemical properties, functional mechanisms, and potential as a biomarker for male fertility issues. Furthermore, characterizing this protein can lead to advancements in understanding the metabolic pathways that support germ cell development and could provide insights into therapeutic strategies for treating infertility. Overall, studying LDHC in the context of recombinant protein technology is essential for dissecting its role in male reproductive biology and could pave the way for innovative clinical applications in reproductive medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US