Analytical Data
-
Gene name
CPT1B
- Application
-
Alternative Names
CPT1B；KIAA1670；Carnitine O-palmitoyltransferase 1. muscle isoform
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92523
-
Expression Region
673-772aa
-
AA Sequence
FLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGYGV SYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKAYS
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CPT1B (Carnitine Palmitoyltransferase 1B) is a crucial enzyme in the mitochondrial fatty acid oxidation pathway, playing a vital role in energy metabolism by facilitating the transport of long-chain fatty acids into the mitochondria. Abnormalities in CPT1B expression and function have been linked to various metabolic disorders, including obesity, insulin resistance, and certain cardiomyopathies. The study of CPT1B recombinant proteins has gained increasing attention in recent years as researchers seek to delineate its physiological roles and regulatory mechanisms. By using recombinant DNA technology, scientists can produce CPT1B in heterologous systems, allowing for detailed analyses of enzyme kinetics, substrate specificity, and potential post-translational modifications. Such studies are essential for understanding the molecular basis of CPT1B-related diseases and may pave the way for developing targeted therapeutic strategies. Furthermore, exploring the interactions of CPT1B with other metabolic pathways may provide insights into its broader effects on cellular energy homeostasis and overall metabolism. Consequently, research on CPT1B recombinant proteins not only enhances our understanding of lipid metabolism but also holds promise for advancing metabolic disease therapeutics.
