Analytical Data
-
Gene name
SLC30A10
- Application
-
Alternative Names
SLC30A10；ZNT10；ZNT8；Calcium/manganese antiporter SLC30A10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6XR72
-
Expression Region
300-485aa
-
AA Sequence
KETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQDASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGALPLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYVNRTHF
-
Molecular Weight
27.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC30A10, a member of the SLC (solute carrier) family, is primarily known for its role in the transport of manganese and other metals across cellular membranes. Research has revealed that mutations in the SLC30A10 gene are associated with disorders such as manganese transport disease, characterized by manganese accumulation that leads to neurological dysfunction. Given its critical physiological role, the study of recombinant SLC30A10 protein has gained prominence in recent years. By producing this protein in a laboratory setting, researchers are able to investigate its structure, function, and interaction with other cellular components. Furthermore, understanding the mechanisms of metal ion transport and the impact of pathological mutations on its function can provide insights into potential therapeutic strategies for related diseases. The recombinant protein can be utilized in various assays to elucidate transport kinetics, substrate specificity, and the effects of different metal ions on its activity. This research not only enhances our comprehension of manganese homeostasis but also contributes to the broader field of metal ion transport in human health and disease.
