Analytical Data
-
Gene name
TIMM10B
- Application
-
Alternative Names
TIMM10B;FXC1;TIM9B;TIMM9B;Mitochondrial import inner membrane translocase subunit Tim10 B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5J6
-
Expression Region
1-103aa
-
AA Sequence
MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
-
Molecular Weight
27.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TIMM10B, a member of the TIM (Translocase of the Inner Membrane) complex, plays a crucial role in mitochondrial protein import and folding. In eukaryotic cells, mitochondria are essential organelles responsible for energy production, and proper mitochondrial function relies on the transport of nuclear-encoded proteins into these organelles. TIMM10B specifically assists in the translocation of preproteins across the inner mitochondrial membrane, facilitating their proper folding and assembly. Research on TIMM10B has gained prominence due to its potential implications in understanding mitochondrial biogenesis and related diseases, including neurodegenerative disorders and metabolic syndromes. Dysfunctions in mitochondrial protein import pathways can lead to impaired energy metabolism and increased oxidative stress, contributing to cellular damage. Therefore, studying TIMM10B not only enhances our comprehension of mitochondrial dynamics but also offers insights into targeted therapies for mitochondrial dysfunction-related diseases. Additionally, advancements in recombinant protein technology have enabled the production of TIMM10B for structural and functional studies, further elucidating its role within the translocase machinery and its interactions with other mitochondrial proteins. This research enhances our understanding of mitochondrial biology and opens avenues for developing therapeutic strategies aimed at mitigating the effects of mitochondrial diseases.











