Analytical Data
-
Gene name
CHIC2
- Application
-
Alternative Names
CHIC2;BTL;Cysteine-rich hydrophobic domain-containing Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UKJ5
-
Expression Region
1-165aa
-
AA Sequence
MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD
-
Molecular Weight
27.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHIC2, or CHIPs protein homolog 2, is a protein that plays a crucial role in cellular processes such as signal transduction, cell survival, and apoptosis. Emerging studies highlight its significance in various diseases, including cancer, where its expression levels are often altered. The research surrounding CHIC2 has gained traction due to its potential as a biomarker for disease progression and as a therapeutic target. Understanding the structure-function relationship of CHIC2 and its interactions with other cellular proteins can shed light on its role in pathophysiological contexts. Recent advances in recombinant protein technology have enabled the production of CHIC2 in sufficient quantities for detailed study. Researchers aim to elucidate its functional mechanisms, assess its involvement in cellular pathways, and explore its potential implications in targeted therapies. The investigation of CHIC2 thus represents a promising area of research, offering insights into both fundamental biology and novel therapeutic avenues.











