Analytical Data
-
Gene name
ALDOS
- Application
-
Alternative Names
ALDOS；Cytochrome P450 11B2. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P19099
-
Expression Region
25-503aa
-
AA Sequence
GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
-
Molecular Weight
71.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ALDOS (Aldose Reductase-Like Protein) is a member of the aldo-keto reductase superfamily, which is involved in various metabolic processes, including glucose metabolism and oxidative stress response. The study of ALDOS has gained significance due to its potential implications in numerous diseases, such as diabetes, diabetic complications, and neurodegenerative disorders. Research has shown that ALDOS plays a crucial role in the conversion of aldoses to their corresponding sugar alcohols, particularly in the context of hyperglycemia, where excessive glucose leads to its reduced forms, contributing to cellular damage and oxidative stress. Understanding the molecular mechanisms underlying ALDOS function and its regulation could open avenues for therapeutic interventions aimed at mitigating the adverse effects of metabolic disorders. Additionally, the recombinant expression of ALDOS provides an opportunity to investigate its enzyme kinetics, structural properties, and interaction with various substrates. By elucidating the functional aspects of ALDOS through recombinant protein studies, researchers aim to develop targeted treatments that can effectively modulate its activity and reduce the pathological consequences associated with its dysregulation. Consequently, the exploration of ALDOS as a potential drug target is at the forefront of current biomedical research, with the objective of improving patient outcomes in metabolic diseases.
