Cat: PA1000-701DB

Recombinant Human CRABP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CRABP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CRABP1;RBP5;Cellular retinoic acid-binding Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P29762

  • Expression Region

    2-137aa

  • AA Sequence

    PNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE

  • Molecular Weight

    42.5kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CRABP1, or Cellular Retinoic Acid-Binding Protein 1, is a crucial protein in the intracellular transport of retinoic acid, a metabolite of vitamin A that plays a significant role in regulating gene expression, cell differentiation, and embryonic development. Research on CRABP1 has gained momentum due to its implications in various physiological processes and its potential involvement in pathological conditions, including cancer and teratogenesis. The protein influences retinoic acid availability to nuclear receptors, thereby modulating signaling pathways that affect cellular growth and development. Studies have indicated that altered levels of CRABP1 may correlate with tumor progression and prognosis in certain cancers, making it a potential biomarker and therapeutic target. Recombinant CRABP1 has been developed for various experimental applications, including structural studies and functional assays, which further elucidate its role in retinoic acid signaling and its interaction with retinoic acid receptors. Understanding CRABP1's structure and function through recombinant protein techniques may enhance our knowledge of retinoid biology and uncover new avenues for therapeutic interventions in retinoic acid-related disorders. This research is pivotal in deciphering the molecular mechanisms of CRABP1 and its impact on health and disease, thereby contributing to the broader field of cell biology and medicinal chemistry.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US